PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.10G107900.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family ARF
Protein Properties Length: 591aa    MW: 66914.2 Da    PI: 6.5101
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.10G107900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B367.12.5e-21120220198
                          EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                          f k+lt sd +++g l + +k+ae++      ++++++ ++l+  d++ ++W +++i+r+k++r+vlt+GW+ +v++++L +gD+++F  
  Manes.10G107900.2.p 120 FHKTLTASDISTRGSLFIYRKHAEDClppldmSQQPPR-QDLIAADLHRNKWHFQHIFRGKPKRHVLTTGWNAYVNSKKLAAGDVFIFL- 207
                          89*****************************7334444.59************************************************. PP

                          -SSSEE..EEEEE- CS
                   B3  85 dgrsefelvvkvfr 98 
                           + ++++ +++v+r
  Manes.10G107900.2.p 208 -RGENGRIHIGVRR 220
                          .4489999**9998 PP

2Auxin_resp91.31.6e-30245326183
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                          a+ha++t+s F v Y+Pr+ +s F+v+v+k+++a k  +svG++fkm+fe e   e ++ Gt+vg++d+++ rWp+SkWr+Lk
  Manes.10G107900.2.p 245 ASHAMTTGSLFCVSYRPRQNSSGFIVNVNKYLEAQKYMYSVGTKFKMRFEDEQILECSFKGTIVGIEDISS-RWPDSKWRCLK 326
                          689*****************************************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.53E-28110227IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.8E-35118235IPR015300DNA-binding pseudobarrel domain
CDDcd100171.25E-18118220No hitNo description
PROSITE profilePS5086310.828120222IPR003340B3 DNA binding domain
PfamPF023622.2E-18120220IPR003340B3 DNA binding domain
SMARTSM010191.7E-14120222IPR003340B3 DNA binding domain
PfamPF065074.7E-28245326IPR010525Auxin response factor
PfamPF023092.2E-11494581IPR033389AUX/IAA domain
PROSITE profilePS5174522.427497587IPR000270PB1 domain
SuperFamilySSF542776.08E-11498574No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 591 aa     Download sequence    Send to blast
MFFSLLLIGG YHYALYKELW DACAGPLVTL PRAGERVYFF PQGYIEQLGA PVHGELEQEM  60
LPFILPSKIL CRVIYVQRMA EPETDQVCAQ IILLPELDQT EITSPDPPLP EQETYTIHSF  120
HKTLTASDIS TRGSLFIYRK HAEDCLPPLD MSQQPPRQDL IAADLHRNKW HFQHIFRGKP  180
KRHVLTTGWN AYVNSKKLAA GDVFIFLRGE NGRIHIGVRR LVRQERDISS VMSSENLHLE  240
VLASASHAMT TGSLFCVSYR PRQNSSGFIV NVNKYLEAQK YMYSVGTKFK MRFEDEQILE  300
CSFKGTIVGI EDISSRWPDS KWRCLKVQWD EPSSILRPER VSPWELEPLV AISTPKFLPG  360
LGKKRARPCL LPSSARYYVD TWKFPSESPA AFSYYDLYSS SSSSSTSKSN SLGFSGFSSQ  420
ASISPNRVEN VVESSAYAVD EEPGNVGDGC PVLSLDTSDQ HSETLNNINQ SEIHSGSCEP  480
KKLCPPSPQE IEGKQIRKHV KVKMQGVAVG RSVDLTQMDC HEDLLRELEK MFDIEGKLRG  540
STKKWEVIYT DEEGDMMLFG DYPWPEFCSM VREIFICASD EIRRMKSRSG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-1611435318359Auxin response factor 1
4ldy_B1e-1611435318359Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012066757.10.0PREDICTED: auxin response factor 1
SwissprotQ8L7G00.0ARFA_ARATH; Auxin response factor 1
TrEMBLA0A067LDD20.0A0A067LDD2_JATCU; Auxin response factor
STRINGPOPTR_0003s00890.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.40.0auxin response factor 1